![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
![]() | Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) ![]() |
![]() | Family c.79.1.0: automated matches [191338] (1 protein) not a true family |
![]() | Protein automated matches [190215] (38 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [188598] (7 PDB entries) |
![]() | Domain d2q3ba_: 2q3b A: [205740] automated match to d3dkib_ complexed with cl, mpd |
PDB Entry: 2q3b (more details), 1.8 Å
SCOPe Domain Sequences for d2q3ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q3ba_ c.79.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} msiaeditqligrtplvrlrrvtdgavadivakleffnpansvkdrigvamlqaaeqagl ikpdtiileptsgntgialamvcaargyrcvltmpetmslerrmllraygaeliltpgad gmsgaiakaeelaktdqryfvpqqfenpanpaihrvttaeevwrdtdgkvdivvagvgtg gtitgvaqvikerkpsarfvavepaaspvlsggqkgphpiqgigagfvppvldqdlvdei itvgnedalnvarrlareegllvgissgaatvaalqvarrpenagklivvvlpdfgeryl
Timeline for d2q3ba_: