![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.132: Heme oxygenase-like [48612] (1 superfamily) multihelical; bundle |
![]() | Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) ![]() duplication: contains two structural repeats of 3-helical motif |
![]() | Family a.132.1.0: automated matches [191333] (1 protein) not a true family |
![]() | Protein automated matches [190172] (8 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225276] (3 PDB entries) |
![]() | Domain d2q32b_: 2q32 B: [205739] automated match to d1wova1 complexed with oxn |
PDB Entry: 2q32 (more details), 2.4 Å
SCOPe Domain Sequences for d2q32b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q32b_ a.132.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} adlsellkegtkeahdraentqfvkdflkgnikkelfklattalyftysaleeemernkd hpafaplyfpmelhrkealtkdmeyffgenweeqvqapkaaqkyverihyigqnepellv ahaytrymgdlsggqvlkkvaqralklpstgegtqfylfenvdnaqqfkqlyrarmnald lnmktkeriveeankafeynmqifneldqagstlaret
Timeline for d2q32b_: