SCOPe 2.08: Domain d2q32a_: 2q32 A:

Lineage for d2q32a_ (2q32 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.0: automated matches [191333] (1 protein)
   not a true family

6. Protein automated matches [190172] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225276] (7 PDB entries)

8. Domain d2q32a_: 2q32 A: [205738]
   automated match to d1wova1
   complexed with oxn

Details for d2q32a_

PDB Entry: 2q32, 2.4 Å

PDB Description: crystal structure of human heme oxygenase-2 c127a (ho-2)

PDB Compounds: (A:) Heme oxygenase 2

SCOPe Domain Sequences for d2q32a_:

Sequence; same for both SEQRES and ATOM records:

>d2q32a_ a.132.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rmadlsellkegtkeahdraentqfvkdflkgnikkelfklattalyftysaleeemern
kdhpafaplyfpmelhrkealtkdmeyffgenweeqvqapkaaqkyverihyigqnepel
lvahaytrymgdlsggqvlkkvaqralklpstgegtqfylfenvdnaqqfkqlyrarmna
ldlnmktkeriveeankafeynmqifneldqag

Timeline for d2q32a_:

• d2q32a_ first appeared in SCOPe 2.03
  
• d2q32a_ appears in SCOPe 2.07