SCOPe 2.08: Domain d2q2ga1: 2q2g A:4-86

Lineage for d2q2ga1 (2q2g A:4-86)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.4: HSP40/DnaJ peptide-binding domain [49492] (1 superfamily)
   sandwich; 6 strands in 2 sheets

4. Superfamily b.4.1: HSP40/DnaJ peptide-binding domain [49493] (2 families)

5. Family b.4.1.0: automated matches [227209] (1 protein)
   not a true family

6. Protein automated matches [226943] (2 species)
   not a true protein

7. Species Cryptosporidium parvum [TaxId:353152] [225279] (1 PDB entry)

8. Domain d2q2ga1: 2q2g A:4-86 [205730]
   automated match to d1c3ga1
   complexed with so4

Details for d2q2ga1

PDB Entry: 2q2g, 1.9 Å

PDB Description: Crystal structure of dimerization domain of HSP40 from Cryptosporidium parvum, cgd2_1800

PDB Compounds: (A:) Heat shock 40 kDa protein, putative (fragment)

SCOPe Domain Sequences for d2q2ga1:

Sequence; same for both SEQRES and ATOM records:

>d2q2ga1 b.4.1.0 (A:4-86) automated matches {Cryptosporidium parvum [TaxId: 353152]}
rshevpllvtleelylgkrkkikvtrkrfiehkvrneeniveveikpgwkdgtkltysge
gdqespgtspgdlvliiqtkthp

Timeline for d2q2ga1:

• d2q2ga1 first appeared in SCOPe 2.03
  
• d2q2ga1 appears in SCOPe 2.07