Lineage for d2q2ga1 (2q2g A:4-86)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770358Fold b.4: HSP40/DnaJ peptide-binding domain [49492] (1 superfamily)
    sandwich; 6 strands in 2 sheets
  4. 2770359Superfamily b.4.1: HSP40/DnaJ peptide-binding domain [49493] (2 families) (S)
  5. 2770373Family b.4.1.0: automated matches [227209] (1 protein)
    not a true family
  6. 2770374Protein automated matches [226943] (2 species)
    not a true protein
  7. 2770375Species Cryptosporidium parvum [TaxId:353152] [225279] (1 PDB entry)
  8. 2770376Domain d2q2ga1: 2q2g A:4-86 [205730]
    automated match to d1c3ga1
    complexed with so4

Details for d2q2ga1

PDB Entry: 2q2g (more details), 1.9 Å

PDB Description: Crystal structure of dimerization domain of HSP40 from Cryptosporidium parvum, cgd2_1800
PDB Compounds: (A:) Heat shock 40 kDa protein, putative (fragment)

SCOPe Domain Sequences for d2q2ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q2ga1 b.4.1.0 (A:4-86) automated matches {Cryptosporidium parvum [TaxId: 353152]}
rshevpllvtleelylgkrkkikvtrkrfiehkvrneeniveveikpgwkdgtkltysge
gdqespgtspgdlvliiqtkthp

SCOPe Domain Coordinates for d2q2ga1:

Click to download the PDB-style file with coordinates for d2q2ga1.
(The format of our PDB-style files is described here.)

Timeline for d2q2ga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2q2ga2