SCOPe 2.06: Domain d2q2ab_: 2q2a B:

Lineage for d2q2ab_ (2q2a B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (140 species)
   not a true protein

7. Species Geobacillus stearothermophilus [TaxId:1422] [225397] (3 PDB entries)

8. Domain d2q2ab_: 2q2a B: [205723]
   automated match to d2xhdb_
   complexed with arg, so4

Details for d2q2ab_

PDB Entry: 2q2a, 1.79 Å

PDB Description: crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus

PDB Compounds: (B:) ArtJ

SCOPe Domain Sequences for d2q2ab_:

Sequence; same for both SEQRES and ATOM records:

>d2q2ab_ c.94.1.0 (B:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
ssggdggatkkkvvvgtdaafapfeymqkgkivgfdvdlldavmkaagldyelknigwdp
lfaslqskevdmgisgititderkqsydfsdpyfeatqvilvkqgspvknaldlkgktig
vqnattgqeaaeklfgkgphikkfettvvaimellnggvdavitdnavaneyvknnpnkk
lqviedpknfaseyygmifpknselkakvdealknvinsgkyteiykkwfgkepkldrlk
q

Timeline for d2q2ab_:

• d2q2ab_ first appeared in SCOPe 2.03
  
• d2q2ab_ appears in SCOPe 2.05
  
• d2q2ab_ appears in SCOPe 2.07
  
• d2q2ab_ appears in the current release, SCOPe 2.08