Lineage for d2q2aa_ (2q2a A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2163419Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2163420Protein automated matches [190039] (140 species)
    not a true protein
  7. 2163776Species Geobacillus stearothermophilus [TaxId:1422] [225397] (3 PDB entries)
  8. 2163778Domain d2q2aa_: 2q2a A: [205722]
    automated match to d2xhdb_
    complexed with arg, so4

Details for d2q2aa_

PDB Entry: 2q2a (more details), 1.79 Å

PDB Description: crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus
PDB Compounds: (A:) ArtJ

SCOPe Domain Sequences for d2q2aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q2aa_ c.94.1.0 (A:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
ssggdggatkkkvvvgtdaafapfeymqkgkivgfdvdlldavmkaagldyelknigwdp
lfaslqskevdmgisgititderkqsydfsdpyfeatqvilvkqgspvknaldlkgktig
vqnattgqeaaeklfgkgphikkfettvvaimellnggvdavitdnavaneyvknnpnkk
lqviedpknfaseyygmifpknselkakvdealknvinsgkyteiykkwfgkepkldrlk
q

SCOPe Domain Coordinates for d2q2aa_:

Click to download the PDB-style file with coordinates for d2q2aa_.
(The format of our PDB-style files is described here.)

Timeline for d2q2aa_: