![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
![]() | Protein automated matches [190069] (203 species) not a true protein |
![]() | Species Bordetella bronchiseptica [TaxId:518] [225344] (8 PDB entries) |
![]() | Domain d2q1wc_: 2q1w C: [205721] automated match to d1e6ua_ complexed with nad |
PDB Entry: 2q1w (more details), 2.19 Å
SCOPe Domain Sequences for d2q1wc_:
Sequence, based on SEQRES records: (download)
>d2q1wc_ c.2.1.0 (C:) automated matches {Bordetella bronchiseptica [TaxId: 518]} hmkkvfitgicgqigshiaelllergdkvvgidnfatgrrehlkdhpnltfvegsiadha lvnqligdlqpdavvhtaasykdpddwyndtltncvggsnvvqaakknnvgrfvyfqtal cygvkpiqqpvrldhprnpanssyaisksanedyleysgldfvtfrlanvvgprnvsgpl piffqrlsegkkcfvtkarrdfvfvkdlaratvravdgvghgayhfssgtdvaikelyda vveamalpsypepeirelgpddapsilldpsrtiqdfgkieftplketvaaavayfreyg
>d2q1wc_ c.2.1.0 (C:) automated matches {Bordetella bronchiseptica [TaxId: 518]} hmkkvfitgicgqigshiaelllergdkvvgidnfatgrrehlkdhpnltfvegsiadha lvnqligdlqpdavvhtaasykdpddwyndtltncvggsnvvqaakknnvgrfvyfqtal cygvkpiqqpvrldhprnpanssyaisksanedyleysgldfvtfrlanvvgprnsgplp iffqrlsegkkcfvtkarrdfvfvkdlaratvravdgvghgayhfssgtdvaikelydav veamalpsypepeirelgapsilldpsrtiqdfgkieftplketvaaavayfreyg
Timeline for d2q1wc_: