Lineage for d2q1wc_ (2q1w C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1830524Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1830525Protein automated matches [190069] (203 species)
    not a true protein
  7. 1830776Species Bordetella bronchiseptica [TaxId:518] [225344] (8 PDB entries)
  8. 1830788Domain d2q1wc_: 2q1w C: [205721]
    automated match to d1e6ua_
    complexed with nad

Details for d2q1wc_

PDB Entry: 2q1w (more details), 2.19 Å

PDB Description: Crystal structure of the Bordetella bronchiseptica enzyme WbmH in complex with NAD+
PDB Compounds: (C:) Putative nucleotide sugar epimerase/ dehydratase

SCOPe Domain Sequences for d2q1wc_:

Sequence, based on SEQRES records: (download)

>d2q1wc_ c.2.1.0 (C:) automated matches {Bordetella bronchiseptica [TaxId: 518]}
hmkkvfitgicgqigshiaelllergdkvvgidnfatgrrehlkdhpnltfvegsiadha
lvnqligdlqpdavvhtaasykdpddwyndtltncvggsnvvqaakknnvgrfvyfqtal
cygvkpiqqpvrldhprnpanssyaisksanedyleysgldfvtfrlanvvgprnvsgpl
piffqrlsegkkcfvtkarrdfvfvkdlaratvravdgvghgayhfssgtdvaikelyda
vveamalpsypepeirelgpddapsilldpsrtiqdfgkieftplketvaaavayfreyg

Sequence, based on observed residues (ATOM records): (download)

>d2q1wc_ c.2.1.0 (C:) automated matches {Bordetella bronchiseptica [TaxId: 518]}
hmkkvfitgicgqigshiaelllergdkvvgidnfatgrrehlkdhpnltfvegsiadha
lvnqligdlqpdavvhtaasykdpddwyndtltncvggsnvvqaakknnvgrfvyfqtal
cygvkpiqqpvrldhprnpanssyaisksanedyleysgldfvtfrlanvvgprnsgplp
iffqrlsegkkcfvtkarrdfvfvkdlaratvravdgvghgayhfssgtdvaikelydav
veamalpsypepeirelgapsilldpsrtiqdfgkieftplketvaaavayfreyg

SCOPe Domain Coordinates for d2q1wc_:

Click to download the PDB-style file with coordinates for d2q1wc_.
(The format of our PDB-style files is described here.)

Timeline for d2q1wc_: