Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
Protein MAP kinase activated protein kinase 2, mapkap2 [82789] (1 species) CaMK group; MAPKAPK subfamily; serine/threonine kinase |
Species Human (Homo sapiens) [TaxId:9606] [82790] (14 PDB entries) |
Domain d2pzyc_: 2pzy C: [205711] automated match to d1nxkc_ complexed with b18, stu |
PDB Entry: 2pzy (more details), 2.9 Å
SCOPe Domain Sequences for d2pzyc_:
Sequence, based on SEQRES records: (download)
>d2pzyc_ d.144.1.7 (C:) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} qfpqfhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpka rrevelhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqafter easeimksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshnslt tpcytpyyvapevlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrirm gqyefpnpewsevseevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsrv lkedkerwedvkeemtsa
>d2pzyc_ d.144.1.7 (C:) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} qfpqfhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpka rrevelhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqafter easeimksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettpyyvap evlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrirmgqyefpnpews evseevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsrvlkedkerwedv keemtsa
Timeline for d2pzyc_: