Lineage for d2pzhc_ (2pzh C:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1409951Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 1409952Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 1410619Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 1410620Protein automated matches [190143] (19 species)
    not a true protein
  7. 1410668Species Helicobacter pylori [TaxId:85962] [225438] (1 PDB entry)
  8. 1410671Domain d2pzhc_: 2pzh C: [205701]
    automated match to d1s5ug_

Details for d2pzhc_

PDB Entry: 2pzh (more details), 1.7 Å

PDB Description: YbgC thioesterase (Hp0496) from Helicobacter pylori
PDB Compounds: (C:) Hypothetical protein HP_0496

SCOPe Domain Sequences for d2pzhc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pzhc_ d.38.1.0 (C:) automated matches {Helicobacter pylori [TaxId: 85962]}
hmrcrvyyedtdsegvvyhanylkycerarsefffkqnvlpeneegvfvirsikadfftp
aslgqvleirtqikelrkvfvvlfqeiyciqnaslepmkpfkvfaseikfgfvnrstysp
iaipklfkellna

SCOPe Domain Coordinates for d2pzhc_:

Click to download the PDB-style file with coordinates for d2pzhc_.
(The format of our PDB-style files is described here.)

Timeline for d2pzhc_: