Lineage for d3mcg21 (3mcg 2:1-111)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 288276Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (8 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 288299Species Human (Homo sapiens), cluster 4 [TaxId:9606] [88539] (23 PDB entries)
  8. 288311Domain d3mcg21: 3mcg 2:1-111 [20570]
    Other proteins in same PDB: d3mcg12, d3mcg22
    part of the antibody MCG light chain dimer

Details for d3mcg21

PDB Entry: 3mcg (more details), 2 Å

PDB Description: three-dimensional structure of a light chain dimer crystallized in water. conformational flexibility of a molecule in two crystal forms

SCOP Domain Sequences for d3mcg21:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mcg21 b.1.1.1 (2:1-111) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 4}
esaltqppsasgslgqsvtisctgtssdvggynyvswyqqhagkapkviiyevnkrpsgv
pdrfsgsksgntasltvsglqaedeadyycssyegsdnfvfgtgtkvtvlg

SCOP Domain Coordinates for d3mcg21:

Click to download the PDB-style file with coordinates for d3mcg21.
(The format of our PDB-style files is described here.)

Timeline for d3mcg21:

View in 3D
Domains from same chain:
(mouse over for more information)
d3mcg22