SCOPe 2.08: Domain d3mcg21: 3mcg 2:1-111

Lineage for d3mcg21 (3mcg 2:1-111)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
   VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family

7. Species Human (Homo sapiens), cluster 4 [TaxId:9606] [88539] (23 PDB entries)

8. Domain d3mcg21: 3mcg 2:1-111 [20570]
   Other proteins in same PDB: d3mcg12, d3mcg22
   part of the antibody MCG light chain dimer

Details for d3mcg21

PDB Entry: 3mcg, 2 Å

PDB Description: three-dimensional structure of a light chain dimer crystallized in water. conformational flexibility of a molecule in two crystal forms

PDB Compounds: (2:) immunoglobulin lambda dimer mcg (light chain)

SCOPe Domain Sequences for d3mcg21:

Sequence; same for both SEQRES and ATOM records:

>d3mcg21 b.1.1.1 (2:1-111) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 4 [TaxId: 9606]}
esaltqppsasgslgqsvtisctgtssdvggynyvswyqqhagkapkviiyevnkrpsgv
pdrfsgsksgntasltvsglqaedeadyycssyegsdnfvfgtgtkvtvlg

Timeline for d3mcg21:

• d3mcg21 first appeared (with stable ids) in SCOP 1.55
  
• d3mcg21 appears in SCOPe 2.07