Lineage for d2pzgb_ (2pzg B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1848535Family c.37.1.12: ABC transporter ATPase domain-like [52686] (24 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 1848551Protein Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain [102378] (2 species)
  7. 1848552Species Human (Homo sapiens) [TaxId:9606] [117543] (9 PDB entries)
    Uniprot P13569 389-671
  8. 1848556Domain d2pzgb_: 2pzg B: [205698]
    automated match to d1l2ta_
    complexed with atp, gol, mg

Details for d2pzgb_

PDB Entry: 2pzg (more details), 1.8 Å

PDB Description: minimal human cftr first nucleotide binding domain as a monomer
PDB Compounds: (B:) Cystic fibrosis transmembrane conductance regulator

SCOPe Domain Sequences for d2pzgb_:

Sequence, based on SEQRES records: (download)

>d2pzgb_ c.37.1.12 (B:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Human (Homo sapiens) [TaxId: 9606]}
ltttevvmenvtafweeggtpvlkdinfkiergqllavagstgagktsllmmimgeleps
egkikhsgrisfcsqfswimpgtikeniifgvsydeyryrsvikacqleediskfaekdn
ivlgeggitlsggqrarislaravykdadlylldspfgyldvltekeifescvcklmank
trilvtskmehlkkadkililhegssyfygtfselqnl

Sequence, based on observed residues (ATOM records): (download)

>d2pzgb_ c.37.1.12 (B:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Human (Homo sapiens) [TaxId: 9606]}
ltttevvmenvtafweeggtpvlkdinfkiergqllavagstgagktsllmmimgeleps
egkikhsgrisfcsqfswimpgtikeniifgvsydeyryrsvikacqleediskfaekdn
ivlgitlsggqrarislaravykdadlylldspfgyldvltekeifescvcklmanktri
lvtskmehlkkadkililhegssyfygtfselqnl

SCOPe Domain Coordinates for d2pzgb_:

Click to download the PDB-style file with coordinates for d2pzgb_.
(The format of our PDB-style files is described here.)

Timeline for d2pzgb_: