![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (15 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187221] (1250 PDB entries) |
![]() | Domain d2pyfb2: 2pyf B:114-241 [205695] Other proteins in same PDB: d2pyfa1, d2pyfb1 automated match to d1qsee2 complexed with pg4, pge, so4 |
PDB Entry: 2pyf (more details), 2.2 Å
SCOPe Domain Sequences for d2pyfb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pyfb2 b.1.1.2 (B:114-241) automated matches {Human (Homo sapiens) [TaxId: 9606]} lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqp lkeqpalndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqivs aeawgrad
Timeline for d2pyfb2: