Lineage for d2pxsa_ (2pxs A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546826Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2546827Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2547682Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2547683Protein automated matches [190526] (25 species)
    not a true protein
  7. 2548204Species Zoanthus sp. [TaxId:105402] [193832] (10 PDB entries)
  8. 2548218Domain d2pxsa_: 2pxs A: [205690]
    automated match to d2pxwb_
    mutant

Details for d2pxsa_

PDB Entry: 2pxs (more details), 2.2 Å

PDB Description: crystal structure of n66d mutant of green fluorescent protein from zoanthus sp. at 2.2 a resolution (mature state)
PDB Compounds: (A:) GFP-like fluorescent chromoprotein FP506

SCOPe Domain Sequences for d2pxsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pxsa_ d.22.1.0 (A:) automated matches {Zoanthus sp. [TaxId: 105402]}
skhgltkemtmkyrmegcvdghkfvitgegigypfkgkqainlcvveggplpfaedilsa
afdygdygnrvfteypqdivdyfknscpagytwdrsflfedgavcicnaditvsveencm
yheskfygvnfpadgpvmkkmtdnwepscekiipvpkqgilkgdvsmylllkdggrlrcq
fdtvykaksvprkmpdwhfiqhkltredrsdaknqkwhltehaiasgsalp

SCOPe Domain Coordinates for d2pxsa_:

Click to download the PDB-style file with coordinates for d2pxsa_.
(The format of our PDB-style files is described here.)

Timeline for d2pxsa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2pxsb_