![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
![]() | Superfamily d.22.1: GFP-like [54511] (3 families) ![]() |
![]() | Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
![]() | Protein automated matches [190526] (25 species) not a true protein |
![]() | Species Zoanthus sp. [TaxId:105402] [193832] (10 PDB entries) |
![]() | Domain d2pxsa_: 2pxs A: [205690] automated match to d2pxwb_ mutant |
PDB Entry: 2pxs (more details), 2.2 Å
SCOPe Domain Sequences for d2pxsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pxsa_ d.22.1.0 (A:) automated matches {Zoanthus sp. [TaxId: 105402]} skhgltkemtmkyrmegcvdghkfvitgegigypfkgkqainlcvveggplpfaedilsa afdygdygnrvfteypqdivdyfknscpagytwdrsflfedgavcicnaditvsveencm yheskfygvnfpadgpvmkkmtdnwepscekiipvpkqgilkgdvsmylllkdggrlrcq fdtvykaksvprkmpdwhfiqhkltredrsdaknqkwhltehaiasgsalp
Timeline for d2pxsa_: