SCOPe 2.08: Domain d2pxsa_: 2pxs A:

Lineage for d2pxsa_ (2pxs A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.0: automated matches [191400] (1 protein)
   not a true family

6. Protein automated matches [190526] (26 species)
   not a true protein

7. Species Zoanthus sp. [TaxId:105402] [193832] (10 PDB entries)

8. Domain d2pxsa_: 2pxs A: [205690]
   automated match to d2pxwb_
   mutant

Details for d2pxsa_

PDB Entry: 2pxs, 2.2 Å

PDB Description: crystal structure of n66d mutant of green fluorescent protein from zoanthus sp. at 2.2 a resolution (mature state)

PDB Compounds: (A:) GFP-like fluorescent chromoprotein FP506

SCOPe Domain Sequences for d2pxsa_:

Sequence; same for both SEQRES and ATOM records:

>d2pxsa_ d.22.1.0 (A:) automated matches {Zoanthus sp. [TaxId: 105402]}
skhgltkemtmkyrmegcvdghkfvitgegigypfkgkqainlcvveggplpfaedilsa
afdygdygnrvfteypqdivdyfknscpagytwdrsflfedgavcicnaditvsveencm
yheskfygvnfpadgpvmkkmtdnwepscekiipvpkqgilkgdvsmylllkdggrlrcq
fdtvykaksvprkmpdwhfiqhkltredrsdaknqkwhltehaiasgsalp

Timeline for d2pxsa_:

• d2pxsa_ first appeared in SCOPe 2.03
  
• d2pxsa_ appears in SCOPe 2.07