SCOPe 2.08: Domain d2px7b_: 2px7 B:

Lineage for d2px7b_ (2px7 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest

4. Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families)

5. Family c.68.1.0: automated matches [191551] (1 protein)
   not a true family

6. Protein automated matches [190951] (34 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [225278] (1 PDB entry)

8. Domain d2px7b_: 2px7 B: [205689]
   automated match to d1vpaa_

Details for d2px7b_

PDB Entry: 2px7, 2.2 Å

PDB Description: crystal structure of 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase from thermus thermophilus hb8

PDB Compounds: (B:) 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase

SCOPe Domain Sequences for d2px7b_:

Sequence, based on SEQRES records:

>d2px7b_ c.68.1.0 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mevsvlipaagnglrlgrgpkaflqvggrtllewtlaafrdaaevlvalppgaeppkglg
avfleggatrqasvarlleaaslplvlvhdvarpfvsrglvarvleaaqrsgaavpvlpv
pdtlmapegeaygrvvpreafrlvqtpqgfftallreahayarrkgleasddaqlvqalg
ypvalvegeatafkithpqdlvlaealarv

Sequence, based on observed residues (ATOM records):

>d2px7b_ c.68.1.0 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mevsvlipaagpkaflqvggrtllewtlaafrdaaevlvalppgaeppkglgavflegga
trqasvarlleaaslplvlvhdvarpfvsrglvarvleaaqrsgaavpvlpvpdtlmape
geaygrvvpreafrlvqtpqgfftallreahayarrkgleasddaqlvqalgypvalveg
eatafkithpqdlvlaealarv

Timeline for d2px7b_:

• d2px7b_ first appeared in SCOPe 2.03
  
• d2px7b_ appears in SCOPe 2.07