![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
![]() | Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) ![]() |
![]() | Family c.68.1.0: automated matches [191551] (1 protein) not a true family |
![]() | Protein automated matches [190951] (34 species) not a true protein |
![]() | Species Thermus thermophilus HB8 [TaxId:300852] [225278] (1 PDB entry) |
![]() | Domain d2px7b_: 2px7 B: [205689] automated match to d1vpaa_ |
PDB Entry: 2px7 (more details), 2.2 Å
SCOPe Domain Sequences for d2px7b_:
Sequence, based on SEQRES records: (download)
>d2px7b_ c.68.1.0 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} mevsvlipaagnglrlgrgpkaflqvggrtllewtlaafrdaaevlvalppgaeppkglg avfleggatrqasvarlleaaslplvlvhdvarpfvsrglvarvleaaqrsgaavpvlpv pdtlmapegeaygrvvpreafrlvqtpqgfftallreahayarrkgleasddaqlvqalg ypvalvegeatafkithpqdlvlaealarv
>d2px7b_ c.68.1.0 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} mevsvlipaagpkaflqvggrtllewtlaafrdaaevlvalppgaeppkglgavflegga trqasvarlleaaslplvlvhdvarpfvsrglvarvleaaqrsgaavpvlpvpdtlmape geaygrvvpreafrlvqtpqgfftallreahayarrkgleasddaqlvqalgypvalveg eatafkithpqdlvlaealarv
Timeline for d2px7b_: