Lineage for d2pwgb2 (2pwg B:479-557)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2810331Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2810332Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2810971Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 2810972Protein automated matches [226835] (41 species)
    not a true protein
  7. 2811163Species Pseudomonas mesoacidophila [TaxId:265293] [224869] (9 PDB entries)
  8. 2811183Domain d2pwgb2: 2pwg B:479-557 [205683]
    Other proteins in same PDB: d2pwga1, d2pwgb1
    automated match to d1m53a1
    complexed with ca, cts

Details for d2pwgb2

PDB Entry: 2pwg (more details), 2.2 Å

PDB Description: crystal structure of the trehalulose synthase mutb from pseudomonas mesoacidophila mx-45 complexed to the inhibitor castanospermine
PDB Compounds: (B:) Sucrose isomerase

SCOPe Domain Sequences for d2pwgb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pwgb2 b.71.1.0 (B:479-557) automated matches {Pseudomonas mesoacidophila [TaxId: 265293]}
gsyrdidpsnadvyaytrsqdgetylvvvnfkaeprsftlpdgmhiaetliessspaapa
agaaslelqpwqsgiykvk

SCOPe Domain Coordinates for d2pwgb2:

Click to download the PDB-style file with coordinates for d2pwgb2.
(The format of our PDB-style files is described here.)

Timeline for d2pwgb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2pwgb1