Lineage for d2pwga1 (2pwg A:2-478)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2829819Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2830345Protein automated matches [190099] (31 species)
    not a true protein
  7. 2830484Species Pseudomonas mesoacidophila [TaxId:265293] [224875] (9 PDB entries)
  8. 2830503Domain d2pwga1: 2pwg A:2-478 [205680]
    Other proteins in same PDB: d2pwga2, d2pwgb2
    automated match to d1m53a2
    complexed with ca, cts

Details for d2pwga1

PDB Entry: 2pwg (more details), 2.2 Å

PDB Description: crystal structure of the trehalulose synthase mutb from pseudomonas mesoacidophila mx-45 complexed to the inhibitor castanospermine
PDB Compounds: (A:) Sucrose isomerase

SCOPe Domain Sequences for d2pwga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pwga1 c.1.8.1 (A:2-478) automated matches {Pseudomonas mesoacidophila [TaxId: 265293]}
pgapwwksavfyqvyprsfkdtngdgigdfkgltekldylkglgidaiwinphyaspntd
ngydisdyrevmkeygtmedfdrlmaelkkrgmrlmvdvvinhssdqhewfkssraskdn
pyrdyyfwrdgkdghepnnypsffggsawekdpvtgqyylhyfgrqqpdlnwdtpklree
lyamlrfwldkgvsgmrfdtvatysktpgfpdltpeqmknfaeaytqgpnlhrylqemhe
kvfdhydavtageifgaplnqvplfidsrrkeldmaftfdlirydraldrwhtiprtlad
frqtidkvdaiageygwntfflgnhdnpravshfgddrpqwreasakalatvtltqrgtp
fifqgdelgmtnypfktlqdfddievkgffqdyvetgkataeelltnvaltsrdnartpf
qwddsanagfttgkpwlkvnpnyteinaareigdpksvysfyrnlisirhetpalst

SCOPe Domain Coordinates for d2pwga1:

Click to download the PDB-style file with coordinates for d2pwga1.
(The format of our PDB-style files is described here.)

Timeline for d2pwga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2pwga2