SCOP 1.55: Domain d2mcg21: 2mcg 2:1-111

Lineage for d2mcg21 (2mcg 2:1-111)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Lambda L chain dimer MCG (human) [48930] (18 PDB entries)

8. Domain d2mcg21: 2mcg 2:1-111 [20568]
   Other proteins in same PDB: d2mcg12, d2mcg22

Details for d2mcg21

PDB Entry: 2mcg, 2 Å

PDB Description: three-dimensional structure of a light chain dimer crystallized in water. conformational flexibility of a molecule in two crystal forms

SCOP Domain Sequences for d2mcg21:

Sequence; same for both SEQRES and ATOM records:

>d2mcg21 b.1.1.1 (2:1-111) Immunoglobulin (variable domains of L and H chains) {Lambda L chain dimer MCG (human)}
esaltqppsasgslgqsvtisctgtssdvggynyvswyqqhagkapkviiyevnkrpsgv
pdrfsgsksgntasltvsglqaedeadyycssyegsdnfvfgtgtkvtvlg

Timeline for d2mcg21:

• d2mcg21 appears in SCOP 1.57
  
• d2mcg21 appears in the current release, SCOPe 2.08