SCOPe 2.08: Domain d2pwfb2: 2pwf B:479-557

Lineage for d2pwfb2 (2pwf B:479-557)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.0: automated matches [227134] (1 protein)
   not a true family

6. Protein automated matches [226835] (41 species)
   not a true protein

7. Species Pseudomonas mesoacidophila [TaxId:265293] [224869] (9 PDB entries)

8. Domain d2pwfb2: 2pwf B:479-557 [205675]
   Other proteins in same PDB: d2pwfa1, d2pwfb1, d2pwfc1, d2pwfd1
   automated match to d1m53a1
   complexed with bgc, ca; mutant

Details for d2pwfb2

PDB Entry: 2pwf, 1.8 Å

PDB Description: crystal structure of the mutb d200a mutant in complex with glucose

PDB Compounds: (B:) Sucrose isomerase

SCOPe Domain Sequences for d2pwfb2:

Sequence; same for both SEQRES and ATOM records:

>d2pwfb2 b.71.1.0 (B:479-557) automated matches {Pseudomonas mesoacidophila [TaxId: 265293]}
gsyrdidpsnadvyaytrsqdgetylvvvnfkaeprsftlpdgmhiaetliessspaapa
agaaslelqpwqsgiykvk

Timeline for d2pwfb2:

• d2pwfb2 first appeared in SCOPe 2.03
  
• d2pwfb2 appears in SCOPe 2.07