Lineage for d2pweb2 (2pwe B:479-557)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2810331Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2810332Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2810971Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 2810972Protein automated matches [226835] (41 species)
    not a true protein
  7. 2811163Species Pseudomonas mesoacidophila [TaxId:265293] [224869] (9 PDB entries)
  8. 2811179Domain d2pweb2: 2pwe B:479-557 [205671]
    Other proteins in same PDB: d2pwea1, d2pweb1
    automated match to d1m53a1
    complexed with ca; mutant

Details for d2pweb2

PDB Entry: 2pwe (more details), 2 Å

PDB Description: crystal structure of the mutb e254q mutant in complex with the substrate sucrose
PDB Compounds: (B:) Sucrose isomerase

SCOPe Domain Sequences for d2pweb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pweb2 b.71.1.0 (B:479-557) automated matches {Pseudomonas mesoacidophila [TaxId: 265293]}
gsyrdidpsnadvyaytrsqdgetylvvvnfkaeprsftlpdgmhiaetliessspaapa
agaaslelqpwqsgiykvk

SCOPe Domain Coordinates for d2pweb2:

Click to download the PDB-style file with coordinates for d2pweb2.
(The format of our PDB-style files is described here.)

Timeline for d2pweb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2pweb1