Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
Protein automated matches [190099] (31 species) not a true protein |
Species Pseudomonas mesoacidophila [TaxId:265293] [224875] (9 PDB entries) |
Domain d2pweb1: 2pwe B:2-478 [205670] Other proteins in same PDB: d2pwea2, d2pweb2 automated match to d1m53a2 complexed with ca; mutant |
PDB Entry: 2pwe (more details), 2 Å
SCOPe Domain Sequences for d2pweb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pweb1 c.1.8.1 (B:2-478) automated matches {Pseudomonas mesoacidophila [TaxId: 265293]} pgapwwksavfyqvyprsfkdtngdgigdfkgltekldylkglgidaiwinphyaspntd ngydisdyrevmkeygtmedfdrlmaelkkrgmrlmvdvvinhssdqhewfkssraskdn pyrdyyfwrdgkdghepnnypsffggsawekdpvtgqyylhyfgrqqpdlnwdtpklree lyamlrfwldkgvsgmrfdtvatysktpgfpdltpeqmknfaeaytqgpnlhrylqemhe kvfdhydavtagqifgaplnqvplfidsrrkeldmaftfdlirydraldrwhtiprtlad frqtidkvdaiageygwntfflgnhdnpravshfgddrpqwreasakalatvtltqrgtp fifqgdelgmtnypfktlqdfddievkgffqdyvetgkataeelltnvaltsrdnartpf qwddsanagfttgkpwlkvnpnyteinaareigdpksvysfyrnlisirhetpalst
Timeline for d2pweb1: