Lineage for d2pwda1 (2pwd A:1-478)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2093019Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2093517Protein automated matches [190099] (25 species)
    not a true protein
  7. 2093635Species Pseudomonas mesoacidophila [TaxId:265293] [224875] (9 PDB entries)
  8. 2093638Domain d2pwda1: 2pwd A:1-478 [205664]
    Other proteins in same PDB: d2pwda2, d2pwdb2
    automated match to d1m53a2
    complexed with ca, noj

Details for d2pwda1

PDB Entry: 2pwd (more details), 1.8 Å

PDB Description: Crystal Structure of the Trehalulose Synthase MUTB from Pseudomonas Mesoacidophila MX-45 Complexed to the Inhibitor Deoxynojirmycin
PDB Compounds: (A:) Sucrose isomerase

SCOPe Domain Sequences for d2pwda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pwda1 c.1.8.1 (A:1-478) automated matches {Pseudomonas mesoacidophila [TaxId: 265293]}
kpgapwwksavfyqvyprsfkdtngdgigdfkgltekldylkglgidaiwinphyaspnt
dngydisdyrevmkeygtmedfdrlmaelkkrgmrlmvdvvinhssdqhewfkssraskd
npyrdyyfwrdgkdghepnnypsffggsawekdpvtgqyylhyfgrqqpdlnwdtpklre
elyamlrfwldkgvsgmrfdtvatysktpgfpdltpeqmknfaeaytqgpnlhrylqemh
ekvfdhydavtageifgaplnqvplfidsrrkeldmaftfdlirydraldrwhtiprtla
dfrqtidkvdaiageygwntfflgnhdnpravshfgddrpqwreasakalatvtltqrgt
pfifqgdelgmtnypfktlqdfddievkgffqdyvetgkataeelltnvaltsrdnartp
fqwddsanagfttgkpwlkvnpnyteinaareigdpksvysfyrnlisirhetpalst

SCOPe Domain Coordinates for d2pwda1:

Click to download the PDB-style file with coordinates for d2pwda1.
(The format of our PDB-style files is described here.)

Timeline for d2pwda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2pwda2