Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily) mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix |
Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) duplication: consists of two similar domain swapped with C-terminal strands |
Family d.21.1.0: automated matches [191386] (1 protein) not a true family |
Protein automated matches [190491] (15 species) not a true protein |
Species Shewanella oneidensis [TaxId:70863] [225314] (3 PDB entries) |
Domain d2pvzb1: 2pvz B:5-185 [205658] automated match to d2h9fa1 complexed with ca, edo |
PDB Entry: 2pvz (more details), 1.97 Å
SCOPe Domain Sequences for d2pvzb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pvzb1 d.21.1.0 (B:5-185) automated matches {Shewanella oneidensis [TaxId: 70863]} lfppqikvaatymrggtskgvffrlqdlpeaaqvpgpardalllrvigspdpyakqidgm ggatsstsktvilshsskanhdvdylfgqvsidkpfvdwsgncgnltaavgafaisngli daariprngvctvriwqanigktiiahvpitdgavqetgdfeldgvtfpaaevqiefmnp a
Timeline for d2pvzb1: