SCOPe 2.06: Domain d2pvzb1: 2pvz B:5-185

Lineage for d2pvzb1 (2pvz B:5-185)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
   mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix

4. Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families)
   duplication: consists of two similar domain swapped with C-terminal strands

5. Family d.21.1.0: automated matches [191386] (1 protein)
   not a true family

6. Protein automated matches [190491] (15 species)
   not a true protein

7. Species Shewanella oneidensis [TaxId:70863] [225314] (3 PDB entries)

8. Domain d2pvzb1: 2pvz B:5-185 [205658]
   automated match to d2h9fa1
   complexed with ca, edo

Details for d2pvzb1

PDB Entry: 2pvz, 1.97 Å

PDB Description: Crystal structure of methylaconitate isomerase PrpF from Shewanella oneidensis

PDB Compounds: (B:) PrpF methylaconitate isomerase

SCOPe Domain Sequences for d2pvzb1:

Sequence; same for both SEQRES and ATOM records:

>d2pvzb1 d.21.1.0 (B:5-185) automated matches {Shewanella oneidensis [TaxId: 70863]}
lfppqikvaatymrggtskgvffrlqdlpeaaqvpgpardalllrvigspdpyakqidgm
ggatsstsktvilshsskanhdvdylfgqvsidkpfvdwsgncgnltaavgafaisngli
daariprngvctvriwqanigktiiahvpitdgavqetgdfeldgvtfpaaevqiefmnp
a

Timeline for d2pvzb1:

• d2pvzb1 first appeared in SCOPe 2.03
  
• d2pvzb1 appears in SCOPe 2.05
  
• d2pvzb1 appears in SCOPe 2.07
  
• d2pvzb1 appears in the current release, SCOPe 2.08