SCOPe 2.08: Domain d2pvqa2: 2pvq A:81-201

Lineage for d2pvqa2 (2pvq A:81-201)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class beta GST [81357] (4 species)

7. Species Ochrobactrum anthropi [TaxId:529] [225312] (2 PDB entries)

8. Domain d2pvqa2: 2pvq A:81-201 [205654]
   Other proteins in same PDB: d2pvqa1
   automated match to d1f2ea1
   complexed with gsh, so4; mutant

Details for d2pvqa2

PDB Entry: 2pvq, 1.8 Å

PDB Description: crystal structure of ochrobactrum anthropi glutathione transferase cys10ala mutant with glutathione bound at the h-site

PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d2pvqa2:

Sequence; same for both SEQRES and ATOM records:

>d2pvqa2 a.45.1.1 (A:81-201) Class beta GST {Ochrobactrum anthropi [TaxId: 529]}
afkpaygsierarlqealgfcsdlhaafsglfapnlseearagvianinrrlgqleamls
dknaywlgddftqpdayasviigwgvgqkldlsaypkalklrervlarpnvqkafkeegl
n

Timeline for d2pvqa2:

• d2pvqa2 first appeared in SCOPe 2.03
  
• d2pvqa2 appears in SCOPe 2.07