Lineage for d2pvqa2 (2pvq A:81-201)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2713010Protein Class beta GST [81357] (4 species)
  7. 2713017Species Ochrobactrum anthropi [TaxId:529] [225312] (2 PDB entries)
  8. 2713018Domain d2pvqa2: 2pvq A:81-201 [205654]
    Other proteins in same PDB: d2pvqa1
    automated match to d1f2ea1
    complexed with gsh, so4; mutant

Details for d2pvqa2

PDB Entry: 2pvq (more details), 1.8 Å

PDB Description: crystal structure of ochrobactrum anthropi glutathione transferase cys10ala mutant with glutathione bound at the h-site
PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d2pvqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pvqa2 a.45.1.1 (A:81-201) Class beta GST {Ochrobactrum anthropi [TaxId: 529]}
afkpaygsierarlqealgfcsdlhaafsglfapnlseearagvianinrrlgqleamls
dknaywlgddftqpdayasviigwgvgqkldlsaypkalklrervlarpnvqkafkeegl
n

SCOPe Domain Coordinates for d2pvqa2:

Click to download the PDB-style file with coordinates for d2pvqa2.
(The format of our PDB-style files is described here.)

Timeline for d2pvqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2pvqa1