SCOPe 2.04: Domain d2pvqa1: 2pvq A:1-80

Lineage for d2pvqa1 (2pvq A:1-80)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class beta GST [81368] (4 species)

7. Species Ochrobactrum anthropi [TaxId:529] [225311] (2 PDB entries)

8. Domain d2pvqa1: 2pvq A:1-80 [205653]
   Other proteins in same PDB: d2pvqa2
   automated match to d1f2ea2
   complexed with gsh, so4; mutant

Details for d2pvqa1

PDB Entry: 2pvq, 1.8 Å

PDB Description: crystal structure of ochrobactrum anthropi glutathione transferase cys10ala mutant with glutathione bound at the h-site

PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d2pvqa1:

Sequence; same for both SEQRES and ATOM records:

>d2pvqa1 c.47.1.5 (A:1-80) Class beta GST {Ochrobactrum anthropi [TaxId: 529]}
mklyykvgaaslaphiilseaglpyeleavdlkakktadggdyfavnprgavpalevkpg
tvitqnaailqyigdhsdva

Timeline for d2pvqa1:

• d2pvqa1 first appeared in SCOPe 2.03
  
• d2pvqa1 appears in SCOPe 2.05
  
• d2pvqa1 appears in the current release, SCOPe 2.08