SCOPe 2.06: Domain d2putb_: 2put B:

Lineage for d2putb_ (2put B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.80: SIS domain [53696] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345

4. Superfamily c.80.1: SIS domain [53697] (4 families)

5. Family c.80.1.0: automated matches [191405] (1 protein)
   not a true family

6. Protein automated matches [190547] (15 species)
   not a true protein

7. Species Candida albicans [TaxId:237561] [194423] (4 PDB entries)

8. Domain d2putb_: 2put B: [205646]
   automated match to d2pocd_
   complexed with act, f6r, na, ud1

Details for d2putb_

PDB Entry: 2put, 1.9 Å

PDB Description: the crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans

PDB Compounds: (B:) isomerase domain of glutamine-fructose-6-phosphate transaminase (isomerizing)

SCOPe Domain Sequences for d2putb_:

Sequence; same for both SEQRES and ATOM records:

>d2putb_ c.80.1.0 (B:) automated matches {Candida albicans [TaxId: 237561]}
pykhfmqkeifeqpdsafntmrgridfencvvtlgglkswlstirrcrriimiacgtsyh
sclatrsifeelteipvsvelasdfldrrspvfrddtcvfvsqsgetadsilalqycler
galtvgivnsvgssmsrqthcgvhinagpeigvastkaytsqyialvmfalslsndsisr
kgrheeiikglqkipeqikqvlklenkikdlcnsslndqksllllgrgyqfatalegalk
ikeisymhsegvlagelkhgilalvdedlpiiafatrdslfpkvmsaieqvtardgrpiv
icnegdaiisndkvhttlevpetvdclqgllnviplqlisywlavnrgidvd

Timeline for d2putb_:

• d2putb_ first appeared in SCOPe 2.03
  
• d2putb_ appears in SCOPe 2.05
  
• d2putb_ appears in SCOPe 2.07
  
• d2putb_ appears in the current release, SCOPe 2.08