Lineage for d2putb_ (2put B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2908082Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 2908083Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 2908303Family c.80.1.0: automated matches [191405] (1 protein)
    not a true family
  6. 2908304Protein automated matches [190547] (18 species)
    not a true protein
  7. 2908340Species Candida albicans [TaxId:237561] [194423] (4 PDB entries)
  8. 2908346Domain d2putb_: 2put B: [205646]
    automated match to d2pocd_
    complexed with act, f6r, na, ud1

Details for d2putb_

PDB Entry: 2put (more details), 1.9 Å

PDB Description: the crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans
PDB Compounds: (B:) isomerase domain of glutamine-fructose-6-phosphate transaminase (isomerizing)

SCOPe Domain Sequences for d2putb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2putb_ c.80.1.0 (B:) automated matches {Candida albicans [TaxId: 237561]}
pykhfmqkeifeqpdsafntmrgridfencvvtlgglkswlstirrcrriimiacgtsyh
sclatrsifeelteipvsvelasdfldrrspvfrddtcvfvsqsgetadsilalqycler
galtvgivnsvgssmsrqthcgvhinagpeigvastkaytsqyialvmfalslsndsisr
kgrheeiikglqkipeqikqvlklenkikdlcnsslndqksllllgrgyqfatalegalk
ikeisymhsegvlagelkhgilalvdedlpiiafatrdslfpkvmsaieqvtardgrpiv
icnegdaiisndkvhttlevpetvdclqgllnviplqlisywlavnrgidvd

SCOPe Domain Coordinates for d2putb_:

Click to download the PDB-style file with coordinates for d2putb_.
(The format of our PDB-style files is described here.)

Timeline for d2putb_: