![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.80: SIS domain [53696] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345 |
![]() | Superfamily c.80.1: SIS domain [53697] (4 families) ![]() |
![]() | Family c.80.1.0: automated matches [191405] (1 protein) not a true family |
![]() | Protein automated matches [190547] (18 species) not a true protein |
![]() | Species Candida albicans [TaxId:237561] [194423] (4 PDB entries) |
![]() | Domain d2putb_: 2put B: [205646] automated match to d2pocd_ complexed with act, f6r, na, ud1 |
PDB Entry: 2put (more details), 1.9 Å
SCOPe Domain Sequences for d2putb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2putb_ c.80.1.0 (B:) automated matches {Candida albicans [TaxId: 237561]} pykhfmqkeifeqpdsafntmrgridfencvvtlgglkswlstirrcrriimiacgtsyh sclatrsifeelteipvsvelasdfldrrspvfrddtcvfvsqsgetadsilalqycler galtvgivnsvgssmsrqthcgvhinagpeigvastkaytsqyialvmfalslsndsisr kgrheeiikglqkipeqikqvlklenkikdlcnsslndqksllllgrgyqfatalegalk ikeisymhsegvlagelkhgilalvdedlpiiafatrdslfpkvmsaieqvtardgrpiv icnegdaiisndkvhttlevpetvdclqgllnviplqlisywlavnrgidvd
Timeline for d2putb_: