Lineage for d2pt9b_ (2pt9 B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2145089Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2145090Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2146607Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2146608Protein automated matches [190689] (64 species)
    not a true protein
  7. 2146886Species Plasmodium falciparum [TaxId:36329] [187826] (16 PDB entries)
  8. 2146907Domain d2pt9b_: 2pt9 B: [205643]
    automated match to d1xj5b_
    complexed with 1pg, 2mh, gol, s4m, so4

Details for d2pt9b_

PDB Entry: 2pt9 (more details), 2.2 Å

PDB Description: the structure of plasmodium falciparum spermidine synthase in complex with decarboxylated s-adenosylmethionine and the inhibitor cis-4- methylcyclohexylamine (4mcha)
PDB Compounds: (B:) spermidine synthase

SCOPe Domain Sequences for d2pt9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pt9b_ c.66.1.0 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]}
kkwfsefsimwpgqafslkikkilyetkskyqnvlvfesttygkvlvldgviqltekdef
ayhemmthvpmtvskepknvlvvgggdggiirelckyksvenidiceidetvievskiyf
kniscgyedkrvnvfiedaskflenvtntydviivdssdpigpaetlfnqnfyekiynal
kpngycvaqceslwihvgtiknmigyakklfkkveyanisiptypcgcigilccsktdtg
ltkpnkkleskefadlkyynyenhsaafklpafllkeien

SCOPe Domain Coordinates for d2pt9b_:

Click to download the PDB-style file with coordinates for d2pt9b_.
(The format of our PDB-style files is described here.)

Timeline for d2pt9b_: