Lineage for d2pt6b_ (2pt6 B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1378488Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1378489Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1379620Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 1379621Protein automated matches [190689] (42 species)
    not a true protein
  7. 1379783Species Plasmodium falciparum [TaxId:36329] [187826] (10 PDB entries)
  8. 1379792Domain d2pt6b_: 2pt6 B: [205640]
    automated match to d1xj5b_
    complexed with 1pg, gol, s4m

Details for d2pt6b_

PDB Entry: 2pt6 (more details), 2 Å

PDB Description: the structure of plasmodium falciparum spermidine synthase in complex with decarboxylated s-adenosylmethionine
PDB Compounds: (B:) spermidine synthase

SCOPe Domain Sequences for d2pt6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pt6b_ c.66.1.0 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]}
kkwfsefsimwpgqafslkikkilyetkskyqnvlvfesttygkvlvldgviqltekdef
ayhemmthvpmtvskepknvlvvgggdggiirelckyksvenidiceidetvievskiyf
kniscgyedkrvnvfiedaskflenvtntydviivdssdpigpaetlfnqnfyekiynal
kpngycvaqceslwihvgtiknmigyakklfkkveyanisiptypcgcigilccsktdtg
ltkpnkkleskefadlkyynyenhsaafklpafllkeien

SCOPe Domain Coordinates for d2pt6b_:

Click to download the PDB-style file with coordinates for d2pt6b_.
(The format of our PDB-style files is described here.)

Timeline for d2pt6b_: