![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
![]() | Species Intact antibody (lambda) MCG (human) [48929] (1 PDB entry) |
![]() | Domain d1mcoh1: 1mco H:1-117 [20564] Other proteins in same PDB: d1mcoh2, d1mcoh3, d1mcoh4, d1mcol2 |
PDB Entry: 1mco (more details), 3.2 Å
SCOP Domain Sequences for d1mcoh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mcoh1 b.1.1.1 (H:1-117) Immunoglobulin (variable domains of L and H chains) {Intact antibody (lambda) MCG (human)} plvlqesgpglvkpsealsltctvsgdsintilyywswirqppgkglewigyiyysgsty gnpslksrvtisvntsknqfysklssvtaadtavyycarvplvvnpwgqgtlvtvss
Timeline for d1mcoh1: