Lineage for d2pssa_ (2pss A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130608Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2130609Protein automated matches [190689] (64 species)
    not a true protein
  7. 2130825Species Plasmodium falciparum [TaxId:36329] [187826] (16 PDB entries)
  8. 2130856Domain d2pssa_: 2pss A: [205636]
    automated match to d1xj5b_
    complexed with 1pg, gol, so4

Details for d2pssa_

PDB Entry: 2pss (more details), 2.2 Å

PDB Description: the structure of plasmodium falciparum spermidine synthase in its apo- form
PDB Compounds: (A:) spermidine synthase

SCOPe Domain Sequences for d2pssa_:

Sequence, based on SEQRES records: (download)

>d2pssa_ c.66.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
kkwfsefsimwpgqafslkikkilyetkskyqnvlvfesttygkvlvldgviqltekdef
ayhemmthvpmtvskepknvlvvgggdggiirelckyksvenidiceidetvievskiyf
kniscgyedkrvnvfiedaskflenvtntydviivdssdpigpaetlfnqnfyekiynal
kpngycvaqceslwihvgtiknmigyakklfkkveyanisiptypcgcigilccsktdtg
ltkpnkkleskefadlkyynyenhsaafklpafllkeieni

Sequence, based on observed residues (ATOM records): (download)

>d2pssa_ c.66.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
kkwfsefsimwpgqafslkikkilyetkskyqnvlvfesttygkvlvldgviqltekdef
ayhemmthvpmtvskepknvlvvgggdggiirelckyksvenidiceidetvievskiyf
kniscgyedkrvnvfiedaskflenvtntydviivdssnfyekiynalkpngycvaqces
lwihvgtiknmigyakklfkkveyanisiptypcgcigilccsktdtgltkpnkkleske
fadlkyynyenhsaafklpafllkeieni

SCOPe Domain Coordinates for d2pssa_:

Click to download the PDB-style file with coordinates for d2pssa_.
(The format of our PDB-style files is described here.)

Timeline for d2pssa_: