Lineage for d1mcol1 (1mco L:1-111)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 288276Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (8 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 288299Species Human (Homo sapiens), cluster 4 [TaxId:9606] [88539] (23 PDB entries)
  8. 288344Domain d1mcol1: 1mco L:1-111 [20563]
    Other proteins in same PDB: d1mcoh1, d1mcoh2, d1mcoh3, d1mcoh4, d1mcol2
    part of intact antibody MCG
    complexed with fuc, gal, man, nag, sia

Details for d1mcol1

PDB Entry: 1mco (more details), 3.2 Å

PDB Description: three-dimensional structure of a human immunoglobulin with a hinge deletion

SCOP Domain Sequences for d1mcol1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mcol1 b.1.1.1 (L:1-111) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 4}
psaltqppsasgslgqsvtisctgtssdvggynyvswyqqhagkapkviiyevnkrpsgv
pdrfsgsksgntasltvsglqaedeadyycssyegsdnfvfgtgtkvtvlg

SCOP Domain Coordinates for d1mcol1:

Click to download the PDB-style file with coordinates for d1mcol1.
(The format of our PDB-style files is described here.)

Timeline for d1mcol1: