SCOP 1.55: Domain d1mcol1: 1mco L:1-111

Lineage for d1mcol1 (1mco L:1-111)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Intact antibody (lambda) MCG (human) [48929] (1 PDB entry)

8. Domain d1mcol1: 1mco L:1-111 [20563]
   Other proteins in same PDB: d1mcoh2, d1mcoh3, d1mcoh4, d1mcol2

Details for d1mcol1

PDB Entry: 1mco, 3.2 Å

PDB Description: three-dimensional structure of a human immunoglobulin with a hinge deletion

SCOP Domain Sequences for d1mcol1:

Sequence; same for both SEQRES and ATOM records:

>d1mcol1 b.1.1.1 (L:1-111) Immunoglobulin (variable domains of L and H chains) {Intact antibody (lambda) MCG (human)}
psaltqppsasgslgqsvtisctgtssdvggynyvswyqqhagkapkviiyevnkrpsgv
pdrfsgsksgntasltvsglqaedeadyycssyegsdnfvfgtgtkvtvlg

Timeline for d1mcol1:

• d1mcol1 appears in SCOP 1.57
  
• d1mcol1 appears in the current release, SCOPe 2.08