Lineage for d1mcol1 (1mco L:1-111)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7952Species Intact antibody (lambda) MCG (human) [48929] (1 PDB entry)
  8. 7954Domain d1mcol1: 1mco L:1-111 [20563]
    Other proteins in same PDB: d1mcoh2, d1mcoh3, d1mcoh4, d1mcol2

Details for d1mcol1

PDB Entry: 1mco (more details), 3.2 Å

PDB Description: three-dimensional structure of a human immunoglobulin with a hinge deletion
PDB Compounds: (L:)

SCOP Domain Sequences for d1mcol1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mcol1 b.1.1.1 (L:1-111) Immunoglobulin (variable domains of L and H chains) {Intact antibody (lambda) MCG (human)}
psaltqppsasgslgqsvtisctgtssdvggynyvswyqqhagkapkviiyevnkrpsgv
pdrfsgsksgntasltvsglqaedeadyycssyegsdnfvfgtgtkvtvlg

SCOP Domain Coordinates for d1mcol1:

Click to download the PDB-style file with coordinates for d1mcol1.
(The format of our PDB-style files is described here.)

Timeline for d1mcol1: