Lineage for d2psfb_ (2psf B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2474355Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2474356Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2476490Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2476491Protein automated matches [190543] (103 species)
    not a true protein
  7. 2477203Species Renilla reniformis [TaxId:6136] [225269] (5 PDB entries)
  8. 2477206Domain d2psfb_: 2psf B: [205627]
    automated match to d2o2ha_

Details for d2psfb_

PDB Entry: 2psf (more details), 1.4 Å

PDB Description: Crystal Structures of the Luciferase and Green Fluorescent Protein from Renilla Reniformis
PDB Compounds: (B:) Renilla-luciferin 2-monooxygenase

SCOPe Domain Sequences for d2psfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2psfb_ c.69.1.0 (B:) automated matches {Renilla reniformis [TaxId: 6136]}
qrkrmitgpqwwarckqmnvldsfinyydsekhaenaviflhgnatssylwrhvvphiep
varciipdligmgksgksgngsyrlldhykyltawfellnlpkkiifvghdwgaalafhy
ayehqdrikaivhmesvvdvieswdewpdieedialikseegekmvlennffvetvlpsk
imrklepeefaaylepfkekgevrrptlswpreiplvkggkpdvvqivrnynaylrasdd
lpklfiesdpgffsnaivegakkfpntefvkvkglhflqedapdemgkyiksfvervlkn
e

SCOPe Domain Coordinates for d2psfb_:

Click to download the PDB-style file with coordinates for d2psfb_.
(The format of our PDB-style files is described here.)

Timeline for d2psfb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2psfa_