Lineage for d2psfa_ (2psf A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1869037Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1869038Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1871035Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 1871036Protein automated matches [190543] (71 species)
    not a true protein
  7. 1871554Species Renilla reniformis [TaxId:6136] [225269] (5 PDB entries)
  8. 1871556Domain d2psfa_: 2psf A: [205626]
    automated match to d2o2ha_

Details for d2psfa_

PDB Entry: 2psf (more details), 1.4 Å

PDB Description: crystal structures of the luciferase and green fluorescent protein from renilla reniformis
PDB Compounds: (A:) Renilla-luciferin 2-monooxygenase

SCOPe Domain Sequences for d2psfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2psfa_ c.69.1.0 (A:) automated matches {Renilla reniformis [TaxId: 6136]}
skvydpeqrkrmitgpqwwarckqmnvldsfinyydsekhaenaviflhgnatssylwrh
vvphiepvarciipdligmgksgksgngsyrlldhykyltawfellnlpkkiifvghdwg
aalafhyayehqdrikaivhmesvvdvieswdewpdieedialikseegekmvlennffv
etvlpskimrklepeefaaylepfkekgevrrptlswpreiplvkggkpdvvqivrnyna
ylrasddlpklfiesdpgffsnaivegakkfpntefvkvkglhflqedapdemgkyiksf
vervlkn

SCOPe Domain Coordinates for d2psfa_:

Click to download the PDB-style file with coordinates for d2psfa_.
(The format of our PDB-style files is described here.)

Timeline for d2psfa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2psfb_