Lineage for d2ps8b_ (2ps8 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2731436Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2731437Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2731844Family a.128.1.5: Trichodiene synthase [69113] (1 protein)
    automatically mapped to Pfam PF06330
  6. 2731845Protein Trichodiene synthase [69114] (1 species)
  7. 2731846Species Fusarium sporotrichioides [TaxId:5514] [69115] (20 PDB entries)
  8. 2731860Domain d2ps8b_: 2ps8 B: [205623]
    automated match to d1jfaa_
    complexed with edo, mg, pop

Details for d2ps8b_

PDB Entry: 2ps8 (more details), 2.67 Å

PDB Description: y295f trichodiene synthase: complex with mg and pyrophosphate
PDB Compounds: (B:) trichodiene synthase

SCOPe Domain Sequences for d2ps8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ps8b_ a.128.1.5 (B:) Trichodiene synthase {Fusarium sporotrichioides [TaxId: 5514]}
menfpteyflnttvrlleyiryrdsnytreerienlhyaynkaahhfaqprqqqllkvdp
krlqaslqtivgmvvyswakvskecmadlsihytytlvlddskddpyptmvnyfddlqag
reqahpwwalvnehfpnvlrhfgpfcslnlirstldffegcwieqynfggfpgshdypqf
lrrmnglghcvgaslwpkeqfnerslfleitsaiaqmenwmvwvndlmsfykefdderdq
islvknyvvsdeislhealekltqdtlhsskqmvavfsdkdpqvmdtiecfmhgfvtwhl
cdrryrlseiyekvkeektedaqkfckfyeqaanvgavspsewayppvaqlanv

SCOPe Domain Coordinates for d2ps8b_:

Click to download the PDB-style file with coordinates for d2ps8b_.
(The format of our PDB-style files is described here.)

Timeline for d2ps8b_: