![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.128: Terpenoid synthases [48575] (1 superfamily) multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers |
![]() | Superfamily a.128.1: Terpenoid synthases [48576] (6 families) ![]() duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J |
![]() | Family a.128.1.5: Trichodiene synthase [69113] (1 protein) automatically mapped to Pfam PF06330 |
![]() | Protein Trichodiene synthase [69114] (1 species) |
![]() | Species Fusarium sporotrichioides [TaxId:5514] [69115] (20 PDB entries) |
![]() | Domain d2ps7a_: 2ps7 A: [205620] automated match to d1jfaa_ complexed with edo, mg |
PDB Entry: 2ps7 (more details), 2.35 Å
SCOPe Domain Sequences for d2ps7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ps7a_ a.128.1.5 (A:) Trichodiene synthase {Fusarium sporotrichioides [TaxId: 5514]} menfpteyflnttvrlleyiryrdsnytreerienlhyaynkaahhfaqprqqqllkvdp krlqaslqtivgmvvyswakvskecmadlsihytytlvlddskddpyptmvnyfddlqag reqahpwwalvnehfpnvlrhfgpfcslnlirstldffegcwieqynfggfpgshdypqf lrrmnglghcvgaslwpkeqfnerslfleitsaiaqmenwmvwvndlmsfykefdderdq islvknyvvsdeislhealekltqdtlhsskqmvavfsdkdpqvmdtiecfmhgfvtwhl cdrryrlseiyekvkeektedaqkfckfyeqaanvgavspsewayppvaqlanv
Timeline for d2ps7a_: