Lineage for d2cd0b_ (2cd0 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2741614Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 2741618Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88535] (4 PDB entries)
    SQ NA # Bence-Jones protein JTO ! Uniprot P06317 # Ig lambda chain V-VI region SUT
  8. 2741624Domain d2cd0b_: 2cd0 B: [20562]
    VL dimer of Bence-Jones protein WIL

Details for d2cd0b_

PDB Entry: 2cd0 (more details), 1.8 Å

PDB Description: structure of human lambda-6 light chain dimer wil
PDB Compounds: (B:) protein (bence-jones protein wil, a variable domain from lambda-6 type immunoglobulin light chain)

SCOPe Domain Sequences for d2cd0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cd0b_ b.1.1.1 (B:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
nflltqphsvsespgktvtisctrssgsiannyvhwyqqrpgsspttvifeddhrpsgvp
drfsgsvdtssnsasltisglktedeadyycqsydhnnqvfgggtkltvlg

SCOPe Domain Coordinates for d2cd0b_:

Click to download the PDB-style file with coordinates for d2cd0b_.
(The format of our PDB-style files is described here.)

Timeline for d2cd0b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2cd0a_