SCOPe 2.08: Domain d2ps6b_: 2ps6 B:

Lineage for d2ps6b_ (2ps6 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.5: Trichodiene synthase [69113] (1 protein)
   automatically mapped to Pfam PF06330

6. Protein Trichodiene synthase [69114] (1 species)

7. Species Fusarium sporotrichioides [TaxId:5514] [69115] (20 PDB entries)

8. Domain d2ps6b_: 2ps6 B: [205619]
   automated match to d1jfaa_
   complexed with edo

Details for d2ps6b_

PDB Entry: 2ps6, 2.6 Å

PDB Description: n225d/s229t trichodiene synthase

PDB Compounds: (B:) trichodiene synthase

SCOPe Domain Sequences for d2ps6b_:

Sequence; same for both SEQRES and ATOM records:

>d2ps6b_ a.128.1.5 (B:) Trichodiene synthase {Fusarium sporotrichioides [TaxId: 5514]}
pteyflnttvrlleyiryrdsnytreerienlhyaynkaahhfaqprqqqllkvdpkrlq
aslqtivgmvvyswakvskecmadlsihytytlvlddskddpyptmvnyfddlqagreqa
hpwwalvnehfpnvlrhfgpfcslnlirstldffegcwieqynfggfpgshdypqflrrm
nglghcvgaslwpkeqfnerslfleitsaiaqmenwmvwvddlmtfykefdderdqislv
knyvvsdeislhealekltqdtlhsskqmvavfsdkdpqvmdtiecfmhgyvtwhlcdrr
yrlseiyekvkeektedaqkfckfyeqaanvgavspsewayppvaqlanv

Timeline for d2ps6b_:

• d2ps6b_ first appeared in SCOPe 2.03
  
• d2ps6b_ appears in SCOPe 2.07