Lineage for d2ps2d2 (2ps2 D:131-370)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2837252Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2837253Protein automated matches [226923] (79 species)
    not a true protein
  7. 2837284Species Aspergillus oryzae [TaxId:510516] [225271] (1 PDB entry)
  8. 2837288Domain d2ps2d2: 2ps2 D:131-370 [205611]
    Other proteins in same PDB: d2ps2a1, d2ps2b1, d2ps2c1, d2ps2d1
    automated match to d1jpma1
    complexed with mg

Details for d2ps2d2

PDB Entry: 2ps2 (more details), 1.8 Å

PDB Description: crystal structure of putative mandelate racemase/muconate lactonizing enzyme from aspergillus oryzae
PDB Compounds: (D:) putative mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d2ps2d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ps2d2 c.1.11.0 (D:131-370) automated matches {Aspergillus oryzae [TaxId: 510516]}
rtntrlplissiyvgepedmrarvakyrakgykgqsvkisgepvtdakritaalanqqpd
effivdangklsvetalrllrllphgldfaleapcatwrecislrrktdipiiydelatn
emsivkiladdaaegidlkiskaggltrgrrqrdiclaagysvsvqetcgsdiafaaivh
laqtiperslrcilecrdmvtvktadgafdiqdgfatapttpglgimprldvlgeavasy

SCOPe Domain Coordinates for d2ps2d2:

Click to download the PDB-style file with coordinates for d2ps2d2.
(The format of our PDB-style files is described here.)

Timeline for d2ps2d2: