Lineage for d2cd0a_ (2cd0 A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 931241Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 931245Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88535] (4 PDB entries)
    SQ NA # Bence-Jones protein JTO ! Uniprot P06317 # Ig lambda chain V-VI region SUT
  8. 931252Domain d2cd0a_: 2cd0 A: [20561]
    VL dimer of Bence-Jones protein WIL

Details for d2cd0a_

PDB Entry: 2cd0 (more details), 1.8 Å

PDB Description: structure of human lambda-6 light chain dimer wil
PDB Compounds: (A:) protein (bence-jones protein wil, a variable domain from lambda-6 type immunoglobulin light chain)

SCOPe Domain Sequences for d2cd0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cd0a_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
nflltqphsvsespgktvtisctrssgsiannyvhwyqqrpgsspttvifeddhrpsgvp
drfsgsvdtssnsasltisglktedeadyycqsydhnnqvfgggtkltvlg

SCOPe Domain Coordinates for d2cd0a_:

Click to download the PDB-style file with coordinates for d2cd0a_.
(The format of our PDB-style files is described here.)

Timeline for d2cd0a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2cd0b_