SCOPe 2.05: Domain d2ps2c2: 2ps2 C:131-370

Lineage for d2ps2c2 (2ps2 C:131-370)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (71 species)
   not a true protein

7. Species Aspergillus oryzae [TaxId:510516] [225271] (1 PDB entry)

8. Domain d2ps2c2: 2ps2 C:131-370 [205609]
   Other proteins in same PDB: d2ps2a1, d2ps2b1, d2ps2c1, d2ps2d1
   automated match to d1jpma1
   complexed with mg

Details for d2ps2c2

PDB Entry: 2ps2, 1.8 Å

PDB Description: crystal structure of putative mandelate racemase/muconate lactonizing enzyme from aspergillus oryzae

PDB Compounds: (C:) putative mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d2ps2c2:

Sequence; same for both SEQRES and ATOM records:

>d2ps2c2 c.1.11.0 (C:131-370) automated matches {Aspergillus oryzae [TaxId: 510516]}
rtntrlplissiyvgepedmrarvakyrakgykgqsvkisgepvtdakritaalanqqpd
effivdangklsvetalrllrllphgldfaleapcatwrecislrrktdipiiydelatn
emsivkiladdaaegidlkiskaggltrgrrqrdiclaagysvsvqetcgsdiafaaivh
laqtiperslrcilecrdmvtvktadgafdiqdgfatapttpglgimprldvlgeavasy

Timeline for d2ps2c2:

• d2ps2c2 first appeared in SCOPe 2.03
  
• d2ps2c2 appears in SCOPe 2.04
  
• d2ps2c2 appears in SCOPe 2.06
  
• d2ps2c2 appears in the current release, SCOPe 2.08