SCOP 1.59: Domain d1cd0b_: 1cd0 B:

Lineage for d1cd0b_ (1cd0 B:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)

7. Species Bence-Jones VL (lambda) dimer JTO (human) [48927] (1 PDB entry)

8. Domain d1cd0b_: 1cd0 B: [20560]

Details for d1cd0b_

PDB Entry: 1cd0, 1.9 Å

PDB Description: structure of human lamda-6 light chain dimer jto

SCOP Domain Sequences for d1cd0b_:

Sequence; same for both SEQRES and ATOM records:

>d1cd0b_ b.1.1.1 (B:) Immunoglobulin (variable domains of L and H chains) {Bence-Jones VL (lambda) dimer JTO (human)}
nfmlnqphsvsespgktvtisctrssgnidsnyvqwyqqrpgsapitviyednqrpsgvp
drfagsidrssnsasltisglktedeadyycqsydarnvvfgggtrltvl

Timeline for d1cd0b_:

• d1cd0b_ first appeared (with stable ids) in SCOP 1.55
  
• d1cd0b_ appears in SCOP 1.57
  
• d1cd0b_ appears in SCOP 1.61
  
• d1cd0b_ appears in the current release, SCOPe 2.08