Lineage for d1cd0b_ (1cd0 B:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88535] (4 PDB entries)
    SQ NA # Bence-Jones protein JTO ! Uniprot P06317 # Ig lambda chain V-VI region SUT
  8. Domain d1cd0b_: 1cd0 B: [20560]
    VL dimer of Bence-Jones protein JTO

Details for d1cd0b_

PDB Entry: 1cd0 (more details), 1.9 Å

PDB Description: structure of human lamda-6 light chain dimer jto
PDB Compounds: (B:) protein (jto, a variable domain from lambda-6 type immunoglobulin light chain)

SCOPe Domain Sequences for d1cd0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cd0b_ b.1.1.1 (B:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
nfmlnqphsvsespgktvtisctrssgnidsnyvqwyqqrpgsapitviyednqrpsgvp
drfagsidrssnsasltisglktedeadyycqsydarnvvfgggtrltvl

SCOPe Domain Coordinates for d1cd0b_ are not available.

Timeline for d1cd0b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1cd0a_