Lineage for d2pr6b_ (2pr6 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970344Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2970628Family d.110.3.0: automated matches [191387] (1 protein)
    not a true family
  6. 2970629Protein automated matches [190492] (24 species)
    not a true protein
  7. 2970633Species Bacillus subtilis [TaxId:1423] [225313] (2 PDB entries)
  8. 2970637Domain d2pr6b_: 2pr6 B: [205599]
    automated match to d4hoia_
    complexed with fmn

Details for d2pr6b_

PDB Entry: 2pr6 (more details), 1.95 Å

PDB Description: structural basis for light-dependent signaling in the dimeric lov photosensor ytva (light structure)
PDB Compounds: (B:) Blue-light photoreceptor

SCOPe Domain Sequences for d2pr6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pr6b_ d.110.3.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
ldhvrvgvvitdpalednpivyvnqgfvqmtgyeteeilgkncrflqgkhtdpaevdnir
talqnkepvtvqiqnykkdgtmfwnelnidpmeiedktyfvgiqnditkqkeyeklleds
lteit

SCOPe Domain Coordinates for d2pr6b_:

Click to download the PDB-style file with coordinates for d2pr6b_.
(The format of our PDB-style files is described here.)

Timeline for d2pr6b_: