SCOPe 2.08: Domain d2pr5b_: 2pr5 B:

Lineage for d2pr5b_ (2pr5 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.0: automated matches [191387] (1 protein)
   not a true family

6. Protein automated matches [190492] (24 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [225313] (2 PDB entries)

8. Domain d2pr5b_: 2pr5 B: [205597]
   automated match to d4hoia_
   complexed with acy, fmn, na

Details for d2pr5b_

PDB Entry: 2pr5, 1.45 Å

PDB Description: structural basis for light-dependent signaling in the dimeric lov photosensor ytva (dark structure)

PDB Compounds: (B:) Blue-light photoreceptor

SCOPe Domain Sequences for d2pr5b_:

Sequence; same for both SEQRES and ATOM records:

>d2pr5b_ d.110.3.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
dhvrvgvvitdpalednpivyvnqgfvqmtgyeteeilgkncrflqgkhtdpaevdnirt
alqnkepvtvqiqnykkdgtmfwnelnidpmeiedktyfvgiqnditkqkeyeklledsl
teital

Timeline for d2pr5b_:

• d2pr5b_ first appeared in SCOPe 2.03
  
• d2pr5b_ appears in SCOPe 2.07