Lineage for d2ppyc_ (2ppy C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1835239Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 1835240Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 1836183Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 1836184Protein automated matches [190246] (49 species)
    not a true protein
  7. 1836303Species Geobacillus kaustophilus [TaxId:235909] [193499] (3 PDB entries)
  8. 1836307Domain d2ppyc_: 2ppy C: [205592]
    automated match to d2uzfa_
    complexed with edo, peg

Details for d2ppyc_

PDB Entry: 2ppy (more details), 2.16 Å

PDB Description: Crystal structure of Enoyl-CoA hydrates (gk_1992) from Geobacillus Kaustophilus HTA426
PDB Compounds: (C:) enoyl-coa hydratase

SCOPe Domain Sequences for d2ppyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ppyc_ c.14.1.0 (C:) automated matches {Geobacillus kaustophilus [TaxId: 235909]}
avetkkqyltvfkedgiaeihlhinksnsydlefykefnaaiddirfdpdikvvivmsdv
pkffsagadinflrsadprfktqfclfcnetldkiarspqvyiacleghtvggglemala
cdlrfmgdeagkiglpevslgvlagtggtqrlarligysraldmnitgetitpqealeig
lvnrvfpqaetrertreyarklansatyavsniklaimngkemplnvairyegelqnllf
rsedakeglsaflekrqpnwkgi

SCOPe Domain Coordinates for d2ppyc_:

Click to download the PDB-style file with coordinates for d2ppyc_.
(The format of our PDB-style files is described here.)

Timeline for d2ppyc_: