Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (49 species) not a true protein |
Species Geobacillus kaustophilus [TaxId:235909] [193499] (3 PDB entries) |
Domain d2ppya_: 2ppy A: [205590] automated match to d2uzfa_ complexed with edo, peg |
PDB Entry: 2ppy (more details), 2.16 Å
SCOPe Domain Sequences for d2ppya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ppya_ c.14.1.0 (A:) automated matches {Geobacillus kaustophilus [TaxId: 235909]} tavetkkqyltvfkedgiaeihlhinksnsydlefykefnaaiddirfdpdikvvivmsd vpkffsagadinflrsadprfktqfclfcnetldkiarspqvyiacleghtvggglemal acdlrfmgdeagkiglpevslgvlagtggtqrlarligysraldmnitgetitpqealei glvnrvfpqaetrertreyarklansatyavsniklaimngkemplnvairyegelqnll frsedakeglsaflekrqpnwkgi
Timeline for d2ppya_: