SCOP 1.71: Domain d1cd0a_: 1cd0 A:

Lineage for d1cd0a_ (1cd0 A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
   VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family

7. Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88535] (4 PDB entries)

8. Domain d1cd0a_: 1cd0 A: [20559]

Details for d1cd0a_

PDB Entry: 1cd0, 1.9 Å

PDB Description: structure of human lamda-6 light chain dimer jto

SCOP Domain Sequences for d1cd0a_:

Sequence; same for both SEQRES and ATOM records:

>d1cd0a_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 1}
nfmlnqphsvsespgktvtisctrssgnidsnyvqwyqqrpgsapitviyednqrpsgvp
drfagsidrssnsasltisglktedeadyycqsydarnvvfgggtrltvlg

Timeline for d1cd0a_:

• d1cd0a_ first appeared (with stable ids) in SCOP 1.55
  
• d1cd0a_ appears in SCOP 1.69
  
• d1cd0a_ appears in SCOP 1.73
  
• d1cd0a_ appears in the current release, SCOPe 2.08